Structure of PDB 6kaj Chain D

Receptor sequence
>6kajD (length=443) Species: 9606 (Homo sapiens) [Search protein sequence]
PRVTVLVREFEAFDNAVPELVDSFLQQDPAQPVVVAADTLPYPPLALPRI
PNVRLALLQPALDRPAAASRPETYVATEFVALVPDGARAEAPGLLERMVE
ALRAGSARLVAAPVATANPARCLALNVSLREWTARYGAAPAAPRCDALDG
DAVVLLRARDLFNLSAPLARPVGTSLFLQTALRGWAVQLLDLTFAAARQP
PLATAHARWKAEREGRARRAALLRALGIRLVSWEGGRLEWFGCNKETTRC
FGTVVGDTPAYLYEERWTPPCCLRALRETARYVVGVLEAAGVRYWLEGGS
LLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEK
AGDFFRVQYSESNHLHVDLWPFYPRNGVMTKDTWLDHRQDVEFPEHFLQP
LVPLPFAGFVAQAPNNYRRFLELKFGPGVIENPQYPNPALLSL
3D structure
PDB6kaj Crystal structures of fukutin-related protein (FKRP), a ribitol-phosphate transferase related to muscular dystrophy.
ChainD
Resolution2.2249 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.8.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN D C289 C296 C317 C318 C243 C250 C271 C272
BS02 CDP D G345 L348 R352 I357 W359 D360 D362 D364 H435 Q437 V477 P481 Q482 Y483 P484 G299 L302 R306 I311 W313 D314 D316 D318 H387 Q389 V429 P433 Q434 Y435 P436
BS03 RB0 D D364 W418 H435 Q437 D438 D318 W370 H387 Q389 D390
Gene Ontology
Molecular Function
GO:0002162 dystroglycan binding
GO:0005515 protein binding
GO:0016740 transferase activity
GO:0016780 phosphotransferase activity, for other substituted phosphate groups
GO:0042802 identical protein binding
GO:0043236 laminin binding
GO:0046872 metal ion binding
Biological Process
GO:0001654 eye development
GO:0001701 in utero embryonic development
GO:0001764 neuron migration
GO:0003007 heart morphogenesis
GO:0003016 respiratory system process
GO:0006096 glycolytic process
GO:0006486 protein glycosylation
GO:0006600 creatine metabolic process
GO:0006629 lipid metabolic process
GO:0006936 muscle contraction
GO:0006954 inflammatory response
GO:0007417 central nervous system development
GO:0007420 brain development
GO:0007507 heart development
GO:0007519 skeletal muscle tissue development
GO:0007628 adult walking behavior
GO:0008104 protein localization
GO:0009100 glycoprotein metabolic process
GO:0009101 glycoprotein biosynthetic process
GO:0009410 response to xenobiotic stimulus
GO:0010001 glial cell differentiation
GO:0010467 gene expression
GO:0014823 response to activity
GO:0016485 protein processing
GO:0017038 protein import
GO:0019321 pentose metabolic process
GO:0019519 pentitol metabolic process
GO:0030198 extracellular matrix organization
GO:0030282 bone mineralization
GO:0035269 protein O-linked mannosylation
GO:0035437 maintenance of protein localization in endoplasmic reticulum
GO:0036058 filtration diaphragm assembly
GO:0036211 protein modification process
GO:0038026 reelin-mediated signaling pathway
GO:0042692 muscle cell differentiation
GO:0043010 camera-type eye development
GO:0043403 skeletal muscle tissue regeneration
GO:0043491 phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0050905 neuromuscular process
GO:0051146 striated muscle cell differentiation
GO:0051262 protein tetramerization
GO:0051384 response to glucocorticoid
GO:0051674 localization of cell
GO:0060538 skeletal muscle organ development
GO:0060539 diaphragm development
GO:0061061 muscle structure development
GO:0061448 connective tissue development
GO:0071711 basement membrane organization
GO:0072592 oxygen metabolic process
GO:0097305 response to alcohol
GO:0097709 connective tissue replacement
GO:0098528 skeletal muscle fiber differentiation
Cellular Component
GO:0000139 Golgi membrane
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005791 rough endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0042383 sarcolemma
GO:0098723 skeletal muscle myofibril

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kaj, PDBe:6kaj, PDBj:6kaj
PDBsum6kaj
PubMed31949166
UniProtQ9H9S5|FKRP_HUMAN Ribitol 5-phosphate transferase FKRP (Gene Name=FKRP)

[Back to BioLiP]