Structure of PDB 6kac Chain D

Receptor sequence

>6kacD (length=348) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

IGTYQEKRTWFDDADDWLRQDRFVFVGWSGLLLFPCAYFALGGWLTGTTF
VTSWYTHGLATSYLEGCNFLTAAVSTPANSMAHSLLFVWGPEAQGDFTRW
CQLGGLWAFVALHGAFGLIGFMLRQFEIARSVNLRPYNAIAFSAPIAVFV
SVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGV
LGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWS
QIFGVAFSNKRWLHFFMLLVPVTGLWMSAIGVVGLALNLRAYDFVSQEIR
AAEDPEFETFYTKNILLNEGIRAWMAAQDQPHERLVFPEEVLPRGNAL

3D structure

PDB

6kac Structural insight into light harvesting for photosystem II in green algae.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	D	E337 R338	E333 R334
BS02	peptide	D	E224 D225 G226 D227 R233 A234 F235 N236 T238 Q239 A240 E241	E220 D221 G222 D223 R229 A230 F231 N232 T234 Q235 A236 E237
BS03	FE2	D	H214 H268	H210 H264
BS04	CLA	D	M198 V201 A202	M194 V197 A198
BS05	CLA	D	V175 I178 F179 I182	V171 I174 F175 I178
BS06	PHO	D	L205 L209 I213 W253 F257	L201 L205 I209 W249 F253
BS07	PHO	D	A41 W48 G121 L122 F125 N142 F146 P149 F153 F173 G174 P275 L279	A37 W44 G117 L118 F121 N138 F142 P145 F149 F169 G170 P271 L275
BS08	CLA	D	F120 I123 M126 L127	F116 I119 M122 L123
BS09	BCT	D	H214 Y244 H268	H210 Y240 H264
BS10	CLA	D	P149 V152 V156 I182 F185 Q186 W191 T192 H197 G200 V201 V204 L279 S282 V286	P145 V148 V152 I178 F181 Q182 W187 T188 H193 G196 V197 V200 L275 S278 V282
BS11	CLA	D	P39 C40 F43 F91 V92 W93 A112 F113 H117 F120	P35 C36 F39 F87 V88 W89 A108 F109 H113 F116

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009507	chloroplast
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6kac, PDBe:6kac, PDBj:6kac
PDBsum	6kac
PubMed	31768031
UniProt	P06007\|PSBD_CHLRE Photosystem II D2 protein (Gene Name=psbD)

[Back to BioLiP]