Structure of PDB 6k1k Chain D

Receptor sequence

>6k1kD (length=96) Species: 9606 (Homo sapiens) [Search protein sequence]

RKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEAS
RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA

3D structure

PDB

6k1k PARP1 exhibits enhanced association and catalytic efficiency with gamma H2A.X-nucleosome.

Chain

Resolution

2.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	S29 R30 Y39 G50 S52 S53 R83 S84 T85	S4 R5 Y14 G25 S27 S28 R58 S59 T60
BS02	dna	D	K27 R28 R30 K31 I36 Y37	K2 R3 R5 K6 I11 Y12

Gene Ontology

	Molecular Function
GO:0001530	lipopolysaccharide binding
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0030527	structural constituent of chromatin
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0002227	innate immune response in mucosa
GO:0006325	chromatin organization
GO:0006334	nucleosome assembly
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway
GO:0019731	antibacterial humoral response
GO:0031640	killing of cells of another organism
GO:0042742	defense response to bacterium
GO:0050829	defense response to Gram-negative bacterium
GO:0050830	defense response to Gram-positive bacterium
GO:0061644	protein localization to CENP-A containing chromatin
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide

	Cellular Component
GO:0000786	nucleosome
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0043505	CENP-A containing nucleosome

External links

PDB	RCSB:6k1k, PDBe:6k1k, PDBj:6k1k
PDBsum	6k1k
PubMed	31848352
UniProt	P06899\|H2B1J_HUMAN Histone H2B type 1-J (Gene Name=H2BC11)