Structure of PDB 6jzw Chain D

Receptor sequence

>6jzwD (length=132) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

NANLDTLYRQVIMDHYKNPRNKGVLNDSIVVDMNNPTCGDRIRLTMKLDG
DIVEDAKFEGEGCSISMASASMMTQAIKGKDIETALSMSKIFSDMMQGKE
LGDIEALQGVSKFPARIKCATLSWKALEKGVA

3D structure

• PDB: 6jzw Zinc-persulfide complex for sulfur mobilization by SufU in SUF-like machinery for Fe-S cluster biosynthesis
• Chain: D
• Resolution: 2.64 Å

Enzymatic activity

• Enzyme Commision number: 2.-.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	D	C41 D43 C66 C128	C38 D40 C63 C119

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0008198 ferrous iron binding
• GO:0016740 transferase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0006879 intracellular iron ion homeostasis
• GO:0016226 iron-sulfur cluster assembly

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6jzw, PDBe:6jzw, PDBj:6jzw
• PDBsum: 6jzw
• UniProt: O32163|SUFU_BACSU Zinc-dependent sulfurtransferase SufU (Gene Name=sufU)