Structure of PDB 6jma Chain D

Receptor sequence
>6jmaD (length=94) Species: 8355 (Xenopus laevis) [Search protein sequence]
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
3D structure
PDB6jma Structural basis of recognition and destabilization of the histone H2B ubiquitinated nucleosome by the DOT1L histone H3 Lys79 methyltransferase.
ChainD
Resolution6.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D T29 R30 I51 S52 S53 R83 S84 T85 T1 R2 I23 S24 S25 R55 S56 T57
BS02 dna D R30 K31 E32 S33 I36 R2 K3 E4 S5 I8
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6jma, PDBe:6jma, PDBj:6jma
PDBsum6jma
PubMed30923167
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]