Structure of PDB 6jf8 Chain D

Receptor sequence
>6jf8D (length=158) Species: 470 (Acinetobacter baumannii) [Search protein sequence]
VVLPVAKRGEDILKLIAAPVSANELNSNWLYQLADAMHATMLERNGVGIA
APQVYISKRVIIVASRPNPRYPDAPEMNAVVMVNPEILEFSSEMCLGEEG
CLSVPDERGQVERAEMVKVKYLTLQGEMVETVFQGFPARIVQHEVDHLNG
ILFVERIS
3D structure
PDB6jf8 K4U bound crystal structure of class I type b peptide deformylase from Acinetobacter baumannii
ChainD
Resolution1.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN D C103 H145 H149 C101 H143 H147
BS02 LHY D G48 V49 G50 Q55 R72 Y73 E101 G102 C103 L104 F138 I142 H145 E146 H149 G46 V47 G48 Q53 R70 Y71 E99 G100 C101 L102 F136 I140 H143 E144 H147
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 29 22:51:51 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6jf8', asym_id = 'D', title = 'K4U bound crystal structure of class I type b peptide deformylase from Acinetobacter baumannii'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6jf8', asym_id='D', title='K4U bound crystal structure of class I type b peptide deformylase from Acinetobacter baumannii')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0042586', uniprot = '', pdbid = '6jf8', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0042586', uniprot='', pdbid='6jf8', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>