Structure of PDB 6iq1 Chain D |
>6iq1D (length=144) Species: 237561 (Candida albicans SC5314) [Search protein sequence] |
ASCIFCKIIKGEIPSFKLIETAKTYSFLDIQPIAEAHVLIIPKHHGAKLH NIPDDYLSDILPVVKKLTKVLKLDENNTPEGEGYNVLQNNGRIAHQVVDH VHFHLIPKKDEATGLGVGWPAEATDFDKLGKLHEKLKEELAKVD |
|
PDB | 6iq1 Crystal Structure of Histidine Triad Nucleotide-Binding Protein from the Pathogenic FungusCandida albicans. |
Chain | D |
Resolution | 2.485 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
C7 C10 H49 H104 |
C3 C6 H45 H100 |
|
|
|
|