Structure of PDB 6ihx Chain D

Receptor sequence

>6ihxD (length=143) Species: 9913 (Bos taurus)

LTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTAD
AVMNNPKVKAHGKKVLDSFSNGMKHLDDLKGTFAALSELHCDKLHVDPEN
FKLLGNVLVVVLARNFGKEFTPVLQADFQKVVAGVANALAHRY

3D structure

• PDB: 6ihx Quaternary Structure Analysis of a Hemoglobin Core in Hemoglobin-Albumin Cluster.
• Chain: D
• Resolution: 1.46 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	D	T38 F41 F42 H63 K66 S70 F71 L88 L91 H92 L96 N102 L106 L141	T36 F39 F40 H61 K64 S68 F69 L86 L89 H90 L94 N100 L104 L139

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0031721 hemoglobin alpha binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:6ihx, PDBe:6ihx, PDBj:6ihx
• PDBsum: 6ihx
• PubMed: 30444368
• UniProt: P02070|HBB_BOVIN Hemoglobin subunit beta (Gene Name=HBB)