Structure of PDB 6iaq Chain D

Receptor sequence

>6iaqD (length=339) Species: 1772 (Mycolicibacterium smegmatis)

HHHHHSDIRAVVYGVGAMNSIVAGMLLDKGVQIVGAIARSPQKVGQDLGD
LLGLGRQLGVAVSDDAAEVLEQTHPDIAVIAVNSYLTDAVEQLRICAEHG
VNAVTLSEEMLYPWETSPELSAELDALAKSTGATLTGTGYQDTFWVNMIA
LLMGTAHRIDTVRGKASWNVDDFGPELATAQQVGRTVAEFDEWVRGAQRP
PTFGRNVLDALVADTGLTVKSITTATRPDIASAAMRSEALGIDLAPGDVI
GFTDIDRIETEEGPVFEFEMSGRVYGPGEGDINEWTIEGEPNLFLSNGTV
PTQTTTCTQMVNRIPDVIAAPPGIVTVDRLPRLRYRPQF

3D structure

• PDB: 6iaq A family of native amine dehydrogenases for the asymmetric reductive amination of ketones
• Chain: D
• Resolution: 1.91 Å

Enzymatic activity

• Enzyme Commision number: 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	D	Y9 V11 G12 A13 M14 R35 S36 K39 A77 V78 N79 S80 L102 E104 Y136 Q137 F169 G170 P171 E172 T302	Y13 V15 G16 A17 M18 R39 S40 K43 A81 V82 N83 S84 L106 E108 Y140 Q141 F173 G174 P175 E176 T306

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 20:32:26 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6iaq', asym_id = 'D', title = 'A family of native amine dehydrogenases for the asymmetric reductive amination of ketones'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6iaq', asym_id='D', title='A family of native amine dehydrogenases for the asymmetric reductive amination of ketones')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0008839,0009089', uniprot = '', pdbid = '6iaq', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008839,0009089', uniprot='', pdbid='6iaq', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>