Structure of PDB 6huj Chain D

Receptor sequence
>6hujD (length=344) Species: 9606,9913 [Search protein sequence]
TTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYT
IDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHN
MTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYA
YTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYV
VMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVT
TVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFT
KRGYAWDGKKTFNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNR
3D structure
PDB6huj GABAAreceptor signalling mechanisms revealed by structural pharmacology.
ChainD
Resolution3.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 RI5 D V257 T261 V246 T250
BS02 PIO D R249 N387 S388 S390 K391 I392 L395 R238 N313 S314 S316 K317 I318 L321
BS03 ABU D F65 R67 T130 F54 R56 T119
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004890 GABA-A receptor activity
GO:0005216 monoatomic ion channel activity
GO:0005230 extracellular ligand-gated monoatomic ion channel activity
GO:0005254 chloride channel activity
GO:0008503 benzodiazepine receptor activity
GO:0016917 GABA receptor activity
GO:0022851 GABA-gated chloride ion channel activity
GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Biological Process
GO:0006811 monoatomic ion transport
GO:0006821 chloride transport
GO:0007214 gamma-aminobutyric acid signaling pathway
GO:0034220 monoatomic ion transmembrane transport
GO:0051932 synaptic transmission, GABAergic
GO:0060078 regulation of postsynaptic membrane potential
GO:1902476 chloride transmembrane transport
GO:1904862 inhibitory synapse assembly
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030659 cytoplasmic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0032590 dendrite membrane
GO:0034707 chloride channel complex
GO:0043005 neuron projection
GO:0043197 dendritic spine
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:0098794 postsynapse
GO:0098982 GABA-ergic synapse
GO:0099634 postsynaptic specialization membrane
GO:1902495 transmembrane transporter complex
GO:1902710 GABA receptor complex
GO:1902711 GABA-A receptor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6huj, PDBe:6huj, PDBj:6huj
PDBsum6huj
PubMed30602790
UniProtP08219|GBRA1_BOVIN Gamma-aminobutyric acid receptor subunit alpha-1 (Gene Name=GABRA1);
P14867|GBRA1_HUMAN Gamma-aminobutyric acid receptor subunit alpha-1 (Gene Name=GABRA1)

[Back to BioLiP]