Structure of PDB 6hui Chain D

Receptor sequence
>6huiD (length=150) Species: 1642 (Listeria innocua) [Search protein sequence]
VDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQ
MDEVAERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVGTL
ELLRDEYKQGIELTDKEGDDVTNDMLIAFKASIDKHIWMFKAFLGKAPLE
3D structure
PDB6hui Metal Positions and Translocation Pathways of the Dodecameric Ferritin-like Protein Dps.
ChainD
Resolution2.995 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.16.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN D D59 E63 D52 E56
BS02 ZN D H32 D48 H25 D41
BS03 ZN D H32 H44 H25 H37
BS04 ZN D E53 H143 E46 H136
BS05 ZN D H16 S84 E113 H9 S77 E106
Gene Ontology
Molecular Function
GO:0008199 ferric iron binding
GO:0016491 oxidoreductase activity
GO:0016722 oxidoreductase activity, acting on metal ions
GO:0046872 metal ion binding
Biological Process
GO:0006879 intracellular iron ion homeostasis
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hui, PDBe:6hui, PDBj:6hui
PDBsum6hui
PubMed31433627
UniProtP80725|DPS_LISIN DNA protection during starvation protein (Gene Name=dps)

[Back to BioLiP]