Structure of PDB 6h3m Chain D

Receptor sequence
>6h3mD (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
3D structure
PDB6h3m Substitution of an Internal Disulfide Bridge with a Diselenide Enhances both Foldability and Stability of Human Insulin.
ChainD
Resolution1.821 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D V2 Q4 V2 Q4
BS02 peptide D S9 H10 V12 E13 Y16 F24 F25 Y26 S9 H10 V12 E13 Y16 F24 F25 Y26
BS03 peptide D F1 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 P28 K29 F1 H5 L6 C7 L15 V18 C19 R22 G23 F24 F25 P28 K29
BS04 peptide D N3 L17 V18 N3 L17 V18
BS05 peptide D Y16 G20 E21 Y16 G20 E21
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6h3m, PDBe:6h3m, PDBj:6h3m
PDBsum6h3m
PubMed31012517
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]