Structure of PDB 6gnq Chain D

Receptor sequence
>6gnqD (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
3D structure
PDB6gnq Monoclinic crystalline form of human insulin, complexed with meta-cresol
ChainD
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 P28 C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 P28
BS02 peptide D L6 S9 H10 L6 S9 H10
BS03 peptide D H5 G8 S9 V12 E13 Y16 E21 G23 F24 F25 Y26 P28 H5 G8 S9 V12 E13 Y16 E21 G23 F24 F25 Y26 P28
BS04 peptide D F1 Q4 F1 Q4
BS05 CRS D H10 L11 H10 L11
BS06 IS8 D L6 H10 L6 H10
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6gnq, PDBe:6gnq, PDBj:6gnq
PDBsum6gnq
PubMed
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]