Structure of PDB 6g0l Chain D

Receptor sequence

>6g0lD (length=95) Species: 8355 (Xenopus laevis)

KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

3D structure

• PDB: 6g0l Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
• Chain: D
• Resolution: 10.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	R30 D48 T49 G50 R83 S84 T85	R3 D21 T22 G23 R56 S57 T58
BS02	dna	D	K28 R30 E32 S33 I36	K1 R3 E5 S6 I9

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 00:04:54 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6g0l', asym_id = 'D', title = 'Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6g0l', asym_id='D', title='Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000786,0003677,0030527,0046982', uniprot = '', pdbid = '6g0l', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000786,0003677,0030527,0046982', uniprot='', pdbid='6g0l', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>