Structure of PDB 6fyx Chain D

Receptor sequence

>6fyxD (length=227) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]

AIISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEIIIRA
TKVQDVVGENGRRINELTLLIEKRFKYKRGTIALYAERVHDRGLSAVAQA
ESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKF
ADGFLIHSGQPVNDFIETATRHVLLRQGVLGIKVKIMKDPSRNTSGPKAL
PDAVTIIEPKEEEPVLEPSVKDYRPTE

3D structure

PDB

6fyx Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	I4 I5 S6 K7 K8 R9 R27 S139 G140 K141 R143 A145 R146 A147 K151 F156 L157 I158 H159 S160 G161 Q162 P163 H174 R178 Q179 V181 G183 K185 P203 D204	I2 I3 S4 K5 K6 R7 R25 S137 G138 K139 R141 A143 R144 A145 K149 F154 L155 I156 H157 S158 G159 Q160 P161 H172 R176 Q177 V179 G181 K183 P201 D202
BS02	rna	D	R94 R116 R117 R143 A144 R146 K148	R92 R114 R115 R141 A142 R144 K146

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6fyx, PDBe:6fyx, PDBj:6fyx
PDBsum	6fyx
PubMed	30475211
UniProt	Q6CRK7

[Back to BioLiP]