Structure of PDB 6fxq Chain D

Receptor sequence

>6fxqD (length=250) Species: 169963 (Listeria monocytogenes EGD-e)

NEAVKTLDGWFCLHDFRSIDWAAWRELNPGNQELMLNELSHFLSDMEITK
NIGEGEHTIYSILGQKADLVFFTLRDSLEALNEVENRFNKLAIADYLLPT
YSYISVVELSNYLASHMAGGDDPYQNKGVRARLYPALPPKKHICFYPMSK
KRDGADNWYMLPMEERQQLIRDHGLIGRSYAGKVQQIIGGSIGFDDYEWG
VTLFSDDALEFKRIVTEMRFDEASARYAEFGSFFIGNLLLSEQLSKLFTI

3D structure

• PDB: 6fxq Redox Cofactor Rotates during Its Stepwise Decarboxylation: Molecular Mechanism of Conversion of Coproheme to Hemeb.
• Chain: D
• Resolution: 1.69 Å

Enzymatic activity

• Enzyme Commision number: 1.3.98.5: hydrogen peroxide-dependent heme synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FEC	D	Y113 R133 Y147 M149 K151 I171 H174 G178 R179 Q187 W200 V202 L204 M219 S225 F231	Y112 R132 Y146 M148 K150 I170 H173 G177 R178 Q186 W199 V201 L203 M218 S224 F230
BS02	VOV	D	E109 S111 Y113 Y147 M149 K151 I171 H174 G178 Q187 W200 V202 L204 M219 S225 F231	E108 S110 Y112 Y146 M148 K150 I170 H173 G177 Q186 W199 V201 L203 M218 S224 F230

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006783 heme biosynthetic process
• GO:0098869 cellular oxidant detoxification

External links

• PDB: RCSB:6fxq, PDBe:6fxq, PDBj:6fxq
• PDBsum: 6fxq
• PubMed: 31423350
• UniProt: Q8Y5F1|CHDC_LISMO Coproheme decarboxylase (Gene Name=chdC)