Structure of PDB 6el8 Chain D

Receptor sequence
>6el8D (length=89) Species: 9606 (Homo sapiens) [Search protein sequence]
SMPKPIYSYSILIFMALKNSKTGSLPVSEIYNFMTEHFPYFKTAPDGWKN
SVRHNLSLNKCFEKVEKGCLWALNPAKIDKMQEELQKWK
3D structure
PDB6el8 Crystal structure of the Forkhead domain of human FOXN1 in complex with DNA
ChainD
Resolution1.61 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D K285 N286 K18 N19
BS02 dna D R320 H321 S324 K331 G343 C344 W346 R53 H54 S57 K64 G68 C69 W71
BS03 dna D K271 Y276 N317 S318 K4 Y9 N50 S51
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6el8, PDBe:6el8, PDBj:6el8
PDBsum6el8
PubMed
UniProtO15353|FOXN1_HUMAN Forkhead box protein N1 (Gene Name=FOXN1)

[Back to BioLiP]