Structure of PDB 6cz7 Chain D

Receptor sequence

>6cz7D (length=234) Species: 94122 (Shewanella sp. ANA-3) [Search protein sequence]

MRLGMVIDLQKCVGCGGCSLACKTENNTNDGIHWSHHIATTEGTFPDVKY
TYIPTLCNHCDDAPCVKVCPTGAMHKDKRGLTLQNNDECIGCKKCMNACP
YGVISFNAATPHRRWQDDSEVVANGTVSPLMLLKRTGATATPNENPERGD
TYPMIRPKRTTEKCTFCDHRLDKGLNPACVDACPSEARVIGDLDDPQSKV
SQLIKLHKPMQLKPEAGTGPRVFYIRSFGVKTAY

3D structure

PDB

6cz7 Structural and mechanistic analysis of the arsenate respiratory reductase provides insight into environmental arsenic transformations.

Chain

Resolution

1.62 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	SF4	D	C12 V13 G14 C15 G16 G17 C18 Y52 P54 C183 P184 R188	C12 V13 G14 C15 G16 G17 C18 Y52 P54 C183 P184 R188
BS02	SF4	D	C22 N26 C164 F166 C167 C179	C22 N26 C164 F166 C167 C179
BS03	SF4	D	C57 N58 H59 C60 A63 C65 T82 C99 Y101 V103 I104 K163	C57 N58 H59 C60 A63 C65 T82 C99 Y101 V103 I104 K163
BS04	SF4	D	C69 P70 C89 I90 G91 C92 K93 C95 T161	C69 P70 C89 I90 G91 C92 K93 C95 T161

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding
GO:0051539	4 iron, 4 sulfur cluster binding

	Cellular Component
GO:0042597	periplasmic space

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6cz7, PDBe:6cz7, PDBj:6cz7
PDBsum	6cz7
PubMed	30104376
UniProt	Q7WTT9\|ARRB_SHESA Arsenate respiratory reductase iron-sulfur subunit ArrB (Gene Name=arrB)

[Back to BioLiP]