Structure of PDB 6cyt Chain D

Receptor sequence
>6cytD (length=48) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence]
MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYG
3D structure
PDB6cyt Structural mechanism for HIV-1 TAR loop recognition by Tat and the super elongation complex.
ChainD
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN D H33 C34 C37 H33 C34 C37
Gene Ontology
Molecular Function
GO:0001070 RNA-binding transcription regulator activity
Biological Process
GO:0050434 positive regulation of viral transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6cyt, PDBe:6cyt, PDBj:6cyt
PDBsum6cyt
PubMed30514815
UniProtP04608|TAT_HV1H2 Protein Tat (Gene Name=tat)

[Back to BioLiP]