Structure of PDB 6cve Chain D

Receptor sequence

>6cveD (length=227) Species: 83332 (Mycobacterium tuberculosis H37Rv)

HGGTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDD
DLAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADL
DRPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNH
TKLTLEALAAQQVSCAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPA
GAASLDAGDFAAMSAAAFDRNWVAGLV

3D structure

• PDB: 6cve Mycobacterium tuberculosis Dethiobiotin Synthetase Facilitates Nucleoside Triphosphate Promiscuity through Alternate Binding Modes
• Chain: D
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T11 G12 K15 T16 K37 T41 G54 E108
• Catalytic site (residue number reindexed from 1): T13 G14 K17 T18 K39 T43 G56 E110
• Enzyme Commision number: 6.3.3.3: dethiobiotin synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DSD	D	L143 G144 L146 N147	L145 G146 L148 N149
BS02	DSD	D	T11 T41 P71 M72 A73 A110 V115	T13 T43 P73 M74 A75 A112 V117
BS03	CTP	D	G12 G14 K15 T16 V17 G169 S170 L196 P197 G199 A200 A201	G14 G16 K17 T18 V19 G171 S172 L198 P199 G201 A202 A203
BS04	MG	D	T16 D49 E108	T18 D51 E110

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004141 dethiobiotin synthase activity
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009102 biotin biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6cve, PDBe:6cve, PDBj:6cve
• PDBsum: 6cve
• UniProt: P9WPQ5|BIOD_MYCTU Dethiobiotin synthetase BioD (Gene Name=bioD)