Structure of PDB 6cl1 Chain D |
>6cl1D (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] |
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQI LTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFS |
|
PDB | 6cl1 Selective and Rapid Cell-Permeable Inhibitor of Human Caspase-3. |
Chain | D |
Resolution | 2.651 Å |
3D structure |
|
|
Enzyme Commision number |
3.4.22.60: caspase-7. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
D |
S231 W232 R233 |
S20 W21 R22 |
|
|
|
|