Structure of PDB 6b5e Chain D

Receptor sequence

>6b5eD (length=286) Species: 83332 (Mycobacterium tuberculosis H37Rv)

MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQ
LITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGAD
SVALVLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAE
GMALSLEEKPVTPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVN
QVYLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLERRQGLKVSIP
EEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLE

3D structure

• PDB: 6b5e The structure of glucose-1-phosphate thymidylyltransferase from Mycobacterium tuberculosis reveals the location of an essential magnesium ion in the RmlA-type enzymes.
• Chain: D
• Resolution: 1.85 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.24: glucose-1-phosphate thymidylyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DAU	D	L6 G8 Q24 Q80 P83 G85 L86 L106 D108 G143 E158 K159 V169 W220 D222	L6 G8 Q24 Q80 P83 G85 L86 L106 D108 G143 E158 K159 V169 W220 D222
BS02	MG	D	D108 D222	D108 D222
BS03	TYD	D	M43 Y112 G113 P114 G115 G117 T118 S119 V247 E252 V253	M43 Y112 G113 P114 G115 G117 T118 S119 V247 E252 V253

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0008879 glucose-1-phosphate thymidylyltransferase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006006 glucose metabolic process
• GO:0009058 biosynthetic process
• GO:0019305 dTDP-rhamnose biosynthetic process
• GO:0045226 extracellular polysaccharide biosynthetic process
• GO:0046075 dTTP metabolic process

Cellular Component

• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall

External links

• PDB: RCSB:6b5e, PDBe:6b5e, PDBj:6b5e
• PDBsum: 6b5e
• PubMed: 29076563
• UniProt: P9WH13|RMLA_MYCTU Glucose-1-phosphate thymidylyltransferase (Gene Name=rmlA)