Structure of PDB 6azr Chain D |
>6azrD (length=121) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence] |
MSKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLI VLDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGAR KVMRKPFSPSQFIEEVKHLLN |
|
PDB | 6azr A pH-gated conformational switch regulates the phosphatase activity of bifunctional HisKA-family histidine kinases. |
Chain | D |
Resolution | 3.628 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
D |
D10 X53 M55 |
D10 X53 M55 |
|
|
|
|