Structure of PDB 6apv Chain D

Receptor sequence
>6apvD (length=176) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]
CKYDFATSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLK
GSFVFTADMVRILGDFGVPTRVEFLRADIRGKHVLVLEDILDTALTLREV
VDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYD
QSYREVRDVVILKPSVYETWGKELER
3D structure
PDB6apv Evaluation of the Trypanosoma brucei 6-oxopurine salvage pathway as a potential target for drug discovery.
ChainD
Resolution1.993 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E113 D114 D117 F166 R179
Catalytic site (residue number reindexed from 1) E88 D89 D92 F141 R154
Enzyme Commision number 2.4.2.8: hypoxanthine phosphoribosyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 3L4 D K54 G55 I115 D117 T118 A119 T121 K145 F166 V167 D173 R179 K50 G51 I90 D92 T93 A94 T96 K120 F141 V142 D148 R154 MOAD: Ki=0.11uM
BS02 MG D G55 S56 E113 D114 G51 S52 E88 D89
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0000287 magnesium ion binding
GO:0004422 hypoxanthine phosphoribosyltransferase activity
GO:0016757 glycosyltransferase activity
GO:0046872 metal ion binding
GO:0052657 guanine phosphoribosyltransferase activity
Biological Process
GO:0006166 purine ribonucleoside salvage
GO:0006178 guanine salvage
GO:0032263 GMP salvage
GO:0032264 IMP salvage
GO:0046100 hypoxanthine metabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0020015 glycosome
GO:0031981 nuclear lumen
GO:0097014 ciliary plasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6apv, PDBe:6apv, PDBj:6apv
PDBsum6apv
PubMed29481567
UniProtQ07010|HPRT_TRYBB Hypoxanthine-guanine phosphoribosyltransferase (Gene Name=HGPRT)

[Back to BioLiP]