Structure of PDB 6ah3 Chain D

Receptor sequence
>6ah3D (length=203) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
DYQRINKNSKIALREYINNCKKNTKKCLKLAYENKITDKEDLLHYIEEKH
PTIYESLPQYVDFVPMYKELWINYIKELLNITKNLKTFNGSLALLKLSMA
DYNGALLRVTKSKNKTLIGLQGIVIWDSQKFFIMIVKGNIIDEIKCIPKK
GTVFQFEIPISDDDDSALRYSILGDRFKYRSVDRAGRKFKSRRCDDMLYY
IQN
3D structure
PDB6ah3 Structural insight into precursor tRNA processing by yeast ribonuclease P.
ChainD
Resolution3.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D R80 K86 Y108 K189 N190 T192 L193 S204 Q205 K206 F207 K221 C222 K226 R4 K10 Y32 K113 N114 T116 L117 S128 Q129 K130 F131 K145 C146 K150
BS02 rna D Y255 R263 K266 Y179 R187 K190
Gene Ontology
Molecular Function
GO:0000171 ribonuclease MRP activity
GO:0003723 RNA binding
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0033204 ribonuclease P RNA binding
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
GO:0000460 maturation of 5.8S rRNA
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0008033 tRNA processing
GO:0034965 intronic box C/D snoRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005655 nucleolar ribonuclease P complex
GO:0030677 ribonuclease P complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ah3, PDBe:6ah3, PDBj:6ah3
PDBsum6ah3
PubMed30262633
UniProtP38336|POP4_YEAST RNases MRP/P 32.9 kDa subunit (Gene Name=POP4)

[Back to BioLiP]