Structure of PDB 6agb Chain D

Receptor sequence

>6agbD (length=227) Species: 559292 (Saccharomyces cerevisiae S288C)

MDRTQTFIKDCLFTKCLEDPEKPFDYQRINKNSKIALREYINNCKKNTKK
CLKLAYENKITDKEDLLHYIEEKHPTIYESLPQYVDFVPMYKELWINYIK
ELLNITKNLKTFNGSLALLKLSMADYNGALLRVTKSKNKTLIGLQGIVIW
DSQKFFIMIVKGNIIDEIKCIPKKGTVFQFEIPISDDDDSALRYSILGDR
FKYRSVDRAGRKFKSRRCDDMLYYIQN

3D structure

• PDB: 6agb Structural insight into precursor tRNA processing by yeast ribonuclease P.
• Chain: D
• Resolution: 3.48 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	R3 T14 E18 R80 K86 I87 K97 Y108 K189 N190 T192 L193 S204 Q205 K206 F207 K221 C222 K226 R256	R3 T14 E18 R28 K34 I35 K45 Y56 K137 N138 T140 L141 S152 Q153 K154 F155 K169 C170 K174 R204

Gene Ontology

Molecular Function

• GO:0000171 ribonuclease MRP activity
• GO:0003723 RNA binding
• GO:0004526 ribonuclease P activity
• GO:0005515 protein binding
• GO:0033204 ribonuclease P RNA binding
• GO:0042134 rRNA primary transcript binding

Biological Process

• GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
• GO:0000460 maturation of 5.8S rRNA
• GO:0001682 tRNA 5'-leader removal
• GO:0006364 rRNA processing
• GO:0006396 RNA processing
• GO:0008033 tRNA processing
• GO:0034965 intronic box C/D snoRNA processing

Cellular Component

• GO:0000172 ribonuclease MRP complex
• GO:0005634 nucleus
• GO:0005655 nucleolar ribonuclease P complex
• GO:0030677 ribonuclease P complex

External links

• PDB: RCSB:6agb, PDBe:6agb, PDBj:6agb
• PDBsum: 6agb
• PubMed: 30262633
• UniProt: P38336|POP4_YEAST RNases MRP/P 32.9 kDa subunit (Gene Name=POP4)