Structure of PDB 5zeb Chain D

Receptor sequence

>5zebD (length=214) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

ARKGILGTKLGMTQVFDENNKVVPVTVVKAGPNVVTRIRTTERDGYSAVQ
LAYGEISPRKVIKPVAGQFAAAGVNPRRHVAELRLDDEAAVAEYEVGQEL
TAEIFSDGAYVDVTGTSKGKGFAGTMKRHGFRGQGAAHGAQAVHRRPGSI
GGCATPGRVFKGTRMSGRMGNDRVTTQNLKVHKVDAENGVLLIKGAIPGR
NGGLVVVRSAIKRG

3D structure

• PDB: 5zeb Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.
• Chain: D
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	M13 Q15 P25 R38 R40 R44 D45 Y47 R60 K61 I63 K64 P65 G68 Q69 E83 R85 S118 K119 G120 K121 G122 F123 G125 R129 F132 R133 Q135 A138 H139 G140 Q142 A143 V144 H145 R146 R147 P148 G149 S150 I151 G152 G153 C154 A155 T156 P157 G158 R159 V160 K162 G163 T164 R165 M166 S167 R169 R174 T176 Q178 N179 A197 I198 P199 R201 I212 K213	M12 Q14 P24 R37 R39 R43 D44 Y46 R59 K60 I62 K63 P64 G67 Q68 E82 R84 S117 K118 G119 K120 G121 F122 G124 R128 F131 R132 Q134 A137 H138 G139 Q141 A142 V143 H144 R145 R146 P147 G148 S149 I150 G151 G152 C153 A154 T155 P156 G157 R158 V159 K161 G162 T163 R164 M165 S166 R168 R173 T175 Q177 N178 A196 I197 P198 R200 I211 K212

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5zeb, PDBe:5zeb, PDBj:5zeb
• PDBsum: 5zeb
• PubMed: 30206241
• UniProt: A0QSD1|RL3_MYCS2 Large ribosomal subunit protein uL3 (Gene Name=rplC)