Structure of PDB 5yxy Chain D

Receptor sequence

>5yxyD (length=124) Species: 69014 (Thermococcus kodakarensis KOD1)

HEWALADAIVRTVLDYAQREGASRVKAVRVVLGELQDVAEDIVKFAMEQL
FAGTIAEGAEIEFVEEEAVFKCRNCNYEWKLKEVKDKFIPEVVHAFLACP
KCGSHDFEVVKGRGVYVAGIKIEK

3D structure

• PDB: 5yxy Crystal structures of a [NiFe] hydrogenase large subunit HyhL in an immature state in complex with a Ni chaperone HypA.
• Chain: D
• Resolution: 3.299 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	D	C73 C76 C110 C113	C72 C75 C99 C102

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0016151 nickel cation binding
• GO:0046872 metal ion binding

Biological Process

• GO:0036211 protein modification process
• GO:0051604 protein maturation

External links

• PDB: RCSB:5yxy, PDBe:5yxy, PDBj:5yxy
• PDBsum: 5yxy
• PubMed: 29915046
• UniProt: Q5JIH3|HYPA_THEKO Hydrogenase maturation factor HypA (Gene Name=hypA)