Structure of PDB 5ypb Chain D

Receptor sequence

>5ypbD (length=44) Species: 9606 (Homo sapiens)

VICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFP

3D structure

• PDB: 5ypb Insights into degradation mechanism of N-end rule substrates by p62/SQSTM1 autophagy adapter.
• Chain: D
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number:
  3.6.4.10: non-chaperonin molecular chaperone ATPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	D	C4 C7 C27 C30	C3 C6 C26 C29
BS02	ZN	D	C18 C21 H36 H39	C17 C20 H35 H38

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding

External links

• PDB: RCSB:5ypb, PDBe:5ypb, PDBj:5ypb
• PDBsum: 5ypb
• PubMed: 30120248
• UniProt: P11021|BIP_HUMAN Endoplasmic reticulum chaperone BiP (Gene Name=HSPA5);
  Q13501|SQSTM_HUMAN Sequestosome-1 (Gene Name=SQSTM1)