Structure of PDB 5yj3 Chain D

Receptor sequence
>5yj3D (length=66) Species: 9606 (Homo sapiens) [Search protein sequence]
PHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYKFTRQAHLRRHME
IHDRVENYNPRQRKLR
3D structure
PDB5yj3 The 11th C2H2 zinc finger and an adjacent C-terminal arm are responsible for TZAP recognition of telomeric DNA.
ChainD
Resolution2.845 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R594 R611 K612 R614 R46 R63 K64 R66 PDBbind-CN: Kd=0.17uM
BS02 dna D R576 Y585 F587 R589 H592 R595 H596 I599 R611 L613 R614 R28 Y37 F39 R41 H44 R47 H48 I51 R63 L65 R66 PDBbind-CN: Kd=0.17uM
BS03 ZN D C580 C583 H596 H600 C32 C35 H48 H52
BS04 ZN D C555 H568 H572 C7 H20 H24
External links
PDB RCSB:5yj3, PDBe:5yj3, PDBj:5yj3
PDBsum5yj3
PubMed29134956
UniProtP10074|TZAP_HUMAN Telomere zinc finger-associated protein (Gene Name=ZBTB48)

[Back to BioLiP]