Structure of PDB 5y8v Chain D |
>5y8vD (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] |
IVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKL HESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKL FQSDTGKKTVVSEFYDEMIFQDPTAMMQQL |
|
PDB | 5y8v Identification of the YEATS domain of GAS41 as a pH-dependent reader of histone succinylation |
Chain | D |
Resolution | 2.61 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
D |
K131 K132 T133 |
K107 K108 T109 |
|
|
|
|