Structure of PDB 5xzj Chain D

Receptor sequence

>5xzjD (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLED
KSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKDAQEAAEHLKTTCNH
CHQKYR

3D structure

• PDB: 5xzj Importance of Scaffold Flexibility/Rigidity in the Design and Directed Evolution of Artificial Metallo-beta-lactamases.
• Chain: D
• Resolution: 1.98 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	D	M7 N11 P46 F61 F65 C98 C101 H102 R106	M7 N11 P46 F61 F65 C98 C101 H102 R106
BS02	ZN	D	H73 H77	H73 H77
BS03	ZN	D	E89 H93	E89 H93

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:5xzj, PDBe:5xzj, PDBj:5xzj
• PDBsum: 5xzj
• PubMed: 28992705
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)