Structure of PDB 5xwd Chain D |
>5xwdD (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] |
SYVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYD SDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHVVFG GGTKLTVL |
|
PDB | 5xwd Cell-free synthesis of functional antibody fragments to provide a structural basis for antibody-antigen interaction |
Chain | D |
Resolution | 2.894 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
S2 H97 |
S1 H96 |
|
|
|