Structure of PDB 5xt6 Chain D |
>5xt6D (length=137) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] |
NLDTLYRQVIMDHYKNPRNKGVLNDSIVVDMNNPTCGDRIRLTMKLDGDI VEDAKFEGEGCSISMASASMMTQAIKGKDIETALSMSKIFSDMMQGKEYD DSIDLGDIEALQGVSKFPARIKCATLSWKALEKGVAK |
|
PDB | 5xt6 Zinc-Ligand Swapping Mediated Complex Formation and Sulfur Transfer between SufS and SufU for Iron-Sulfur Cluster Biogenesis in Bacillus subtilis |
Chain | D |
Resolution | 3.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
D43 C66 C128 |
D38 C61 C123 |
|
|
|
|