Structure of PDB 5xm0 Chain D

Receptor sequence
>5xm0D (length=94) Species: 10090 (Mus musculus) [Search protein sequence]
RGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRL
AHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
3D structure
PDB5xm0 Histone H3.3 sub-variant H3mm7 is required for normal skeletal muscle regeneration.
ChainD
Resolution2.874 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R31 R33 I54 S55 S56 R86 S87 T88 R1 R3 I24 S25 S26 R56 S57 T58
BS02 dna D R33 K34 E35 S36 Y40 R3 K4 E5 S6 Y10
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5xm0, PDBe:5xm0, PDBj:5xm0
PDBsum5xm0
PubMed29643389
UniProtQ9D2U9|H2B3A_MOUSE H2B.U histone 2 (Gene Name=H2bu2)

[Back to BioLiP]