Structure of PDB 5x8t Chain D

Receptor sequence

>5x8tD (length=212) Species: 3562 (Spinacia oleracea)

VDAGIGVMGTKLGMMSFFEEDGTVVPVTVIGFKEGNIVTQVKTESTDGYN
AVQVGYERLRDRKLTMPERGHLNKAGVIPMRHLQEFRLVSVDDFTPSQKL
LFEELFKEGDMVDISGTTIGKGFQGGIKRHNFKRGLMTHGSKSHRALGSI
GAGTTPGHVYKGKKMPGRMGGTKTKIRKLKIMKIDTDLRVVMIKGAVPGK
PGNLLRLAPAKI

3D structure

• PDB: 5x8t Unique localization of the plastid-specific ribosomal proteins in the chloroplast ribosome small subunit provides mechanistic insights into the chloroplastic translation
• Chain: D
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	K118 E119 R143 L144 R145 K148 T150 M151 R166 I204 G205 G207 F208 R253 K285 P286	K33 E34 R58 L59 R60 K63 T65 M66 R81 I119 G120 G122 F123 R168 K200 P201
BS02	rna	D	M99 M100 P111 Y134 P152 E153 G155 H156 K159 L168 Q169 E170 R172 T203 I204 K206 F208 G210 N216 F217 K218 R219 L221 M222 T223 H224 G225 K227 H229 R230 G233 S234 I235 G236 A237 G238 T239 T240 P241 G242 H243 V244 Y245 K246 G247 K248 M250 P251 R253 K258 T259 K260 I261 R262 K263 L264 K279 V282 G284 K285 K296	M14 M15 P26 Y49 P67 E68 G70 H71 K74 L83 Q84 E85 R87 T118 I119 K121 F123 G125 N131 F132 K133 R134 L136 M137 T138 H139 G140 K142 H144 R145 G148 S149 I150 G151 A152 G153 T154 T155 P156 G157 H158 V159 Y160 K161 G162 K163 M165 P166 R168 K173 T174 K175 I176 R177 K178 L179 K194 V197 G199 K200 K211

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:5x8t, PDBe:5x8t, PDBj:5x8t
• PDBsum: 5x8t
• PubMed: 28582576
• UniProt: P82191|RK3_SPIOL Large ribosomal subunit protein uL3c (Gene Name=RPL3)