Structure of PDB 5ww9 Chain D |
>5ww9D (length=161) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] |
MSARRTESDIQGFHATPEFGGNLQKVLVDLIELSLQGKQAHWNVVGSNFR DLHLQLDELVDFAREGSDTIAEEMRALDAVPDGRSDTVAATTTLPEFPAF ERSTADVVDLITTRINATVDTIRRVHDAVDAEDPSTADLLHGLIDGLEKQ AWLIRSENRKV |
|
PDB | 5ww9 Flexible aspartates propel iron to the ferroxidation sites along pathways stabilized by a conserved arginine in Dps proteins from Mycobacterium smegmatis |
Chain | D |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
D |
N48 D51 |
N48 D51 |
|
BS02 |
FE |
D |
D68 E72 |
D68 E72 |
|
|
|
|