Structure of PDB 5wuq Chain D |
>5wuqD (length=69) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] |
CPEQIVQLMHMHLDGDILPKDEHVLNEHLETCEKCRKHFYEMEKSIALVR STSHVEAPADFTANVMAKL |
|
PDB | 5wuq Structural insights into the regulation of Bacillus subtilis SigW activity by anti-sigma RsiW |
Chain | D |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
H30 C34 C37 |
H28 C32 C35 |
|
|
|