Structure of PDB 5wlw Chain D |
>5wlwD (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] |
MSVDLSTQVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVD EKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELC LPPVKLHCSILAEDAIKAALADYKLKQE |
|
PDB | 5wlw Structure and functional dynamics of the mitochondrial Fe/S cluster synthesis complex. |
Chain | D |
Resolution | 3.317 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
D46 C70 H112 |
D41 C65 H107 |
|
|
|
|