Structure of PDB 5vde Chain D |
>5vdeD (length=70) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
IKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPY DFILEKIKKTGKEVRSGKQL |
|
PDB | 5vde The crystal structures of a copper-bound metallochaperone from Saccharomyces cerevisiae. |
Chain | D |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
D |
C15 C18 |
C12 C15 |
|
|
|
|