Structure of PDB 5uze Chain D

Receptor sequence

>5uzeD (length=342) Species: 195103 (Clostridium perfringens ATCC 13124)

RILKTAYTFDDVLLVPNKSEVLPNEVSLKTQLTKKIQLNIPLMSASMDTV
TESKMAIAMAREGGIGIIHKNMTIEDQAREVDRVKRSGGLLCGASIGVTN
DMMERVDAVVKAKVDVIVLDTAHGHSKGVIEGVKRIKAKYPELQVIAGNI
ATPEAVRDLAEAGADCVKVGIGPGSICTTRIVAGVGVPQLTAVMDCAEEG
KKLGIPVIADGGLKYSGDIVKALAAGACAAMMGSIFAGCEEAPGAIEIYQ
GRSYKVYRGMGSLGAMAKFVPEGVEGRIAYKGHLADTIYQLIGGIKSGMG
YLGAPTLENLYENANFVVQTSAGFRESHPHDINITKEAPNYS

3D structure

• PDB: 5uze Crystal Structure of Inosine 5'-monophosphate Dehydrogenase from Clostridium perfringens Complexed with IMP and P182
• Chain: D
• Resolution: 2.27 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.205: IMP dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	8L1	D	P25 S436 G439 Y440	P23 S297 G300 Y301
BS02	IMP	D	M49 G300 S301 I302 C303 D336 G338 M358 G359 S360 Y383 G385 M386 G387 E411	M47 G174 S175 I176 C177 D210 G212 M232 G233 S234 Y257 G259 M260 G261 E272
BS03	8L1	D	V224 T247 A248 H249 M386 G387 M392 E411	V98 T121 A122 H123 M260 G261 M266 E272

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0003938 IMP dehydrogenase activity
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0006164 purine nucleotide biosynthetic process

External links

• PDB: RCSB:5uze, PDBe:5uze, PDBj:5uze
• PDBsum: 5uze
• UniProt: A0A0H2YRZ7