Structure of PDB 5ura Chain D

Receptor sequence

>5uraD (length=134) Species: 9606 (Homo sapiens)

SHMVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGD
KVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKW
DGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

3D structure

• PDB: 5ura The Antinociceptive Agent SBFI-26 Binds to Anandamide Transporters FABP5 and FABP7 at Two Different Sites.
• Chain: D
• Resolution: 1.85002 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	8KS	D	F17 M21 T30 G34 T37 P39 S56 F58 D77 F105 M116 L118 R127 Y129	F19 M23 T32 G36 T39 P41 S58 F60 D79 F107 M118 L120 R129 Y131	MOAD: Ki=0.4uM BindingDB: Ki=450nM

Gene Ontology

Molecular Function

• GO:0005504 fatty acid binding
• GO:0005515 protein binding
• GO:0008289 lipid binding

Biological Process

• GO:0007399 nervous system development
• GO:0008285 negative regulation of cell population proliferation
• GO:0015908 fatty acid transport
• GO:0050673 epithelial cell proliferation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:5ura, PDBe:5ura, PDBj:5ura
• PDBsum: 5ura
• PubMed: 28632393
• UniProt: O15540|FABP7_HUMAN Fatty acid-binding protein, brain (Gene Name=FABP7)