Structure of PDB 5umd Chain D

Receptor sequence

>5umdD (length=247) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

GRVIRGQRKGRGSIFKSHNHHRKGAAKLRHLDYCEKKGYIKGLVKDIIHD
PGRGAPLAKVIFKRTEKYGKKEELIIASEGMFTGQYISCGTKAPLSVGNI
LPIGKMPEGTLICNLEHRTGNRGTLVKASGCYATVVGQSEDGKKTKVRLP
SGAKKTIDAKARAMVGVVGAGGRIDKPILKAGVAHHKYRVKRNCWPKVRG
VAMNPVEHPHGGGNHQHIGHPSTVSRSAPAGQKVGLIAARRTGLLRG

3D structure

PDB

5umd Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	G2 R3 V4 G7 Q8 R9 K10 G11 R12 S14 I15 K17 S18 H19 N20 H21 H22 R23 G25 A26 H31 Y34 K38 L44 H50 P52 R54 K64 R65 E67 K68 Y69 G70 K71 G85 H118 R119 R123 T125 L126 V127 K128 A129 S130 G131 C132 L150 P151 S152 K156 G173 R174 I175 K177 P178 I179 L180 K181 A182 G183 H186 H187 K188 V191 K192 R193 W196 P197 K198 V199 R200 G201 V202 A203 M204 N205 P206 V207 E208 H209 H211 G213 G214 N215 H216 Q217 H218 I219 G220 H221 P222 S223 T224 S226 R227 P230 A231 G232 Q233 K234 V235 G236 I238 A239 A240 R241 R242 T243 G244 L245 L246	G1 R2 V3 G6 Q7 R8 K9 G10 R11 S13 I14 K16 S17 H18 N19 H20 H21 R22 G24 A25 H30 Y33 K37 L43 H49 P51 R53 K63 R64 E66 K67 Y68 G69 K70 G84 H117 R118 R122 T124 L125 V126 K127 A128 S129 G130 C131 L149 P150 S151 K155 G172 R173 I174 K176 P177 I178 L179 K180 A181 G182 H185 H186 K187 V190 K191 R192 W195 P196 K197 V198 R199 G200 V201 A202 M203 N204 P205 V206 E207 H208 H210 G212 G213 N214 H215 Q216 H217 I218 G219 H220 P221 S222 T223 S225 R226 P229 A230 G231 Q232 K233 V234 G235 I237 A238 A239 R240 R241 T242 G243 L244 L245
BS02	MG	D	K198 R200	K197 R199

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5umd, PDBe:5umd, PDBj:5umd
PDBsum	5umd
PubMed	28288098
UniProt	Q8I3T9

[Back to BioLiP]