Structure of PDB 5ttf Chain D

Receptor sequence

>5ttfD (length=261) Species: 9606 (Homo sapiens)

TEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRN
ITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFEC
NQACSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEY
VGELISDAEADVREDDSYLFDLDEVYCIDARYYGNISRFINHLCDPNIIP
VRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCG
SEKCKHSAEAI

3D structure

• PDB: 5ttf Discovery of Potent and Selective Inhibitors for G9a-Like Protein (GLP) Lysine Methyltransferase.
• Chain: D
• Resolution: 1.72 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y1067 Y1154
• Catalytic site (residue number reindexed from 1): Y150 Y233
• Enzyme Commision number: 2.1.1.-
  2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	D	C974 C987 C1017 C1021	C57 C70 C100 C104
BS02	ZN	D	C980 C1017 C1023 C1027	C63 C100 C106 C110
BS03	ZN	D	C974 C976 C980 C985	C57 C59 C63 C68
BS04	ZN	D	C1115 C1168 C1170 C1175	C194 C247 C249 C254
BS05	SAM	D	M1048 G1049 W1050 S1084 Y1085 R1109 F1110 N1112 H1113 Y1154 F1166 C1168	M131 G132 W133 S167 Y168 R188 F189 N191 H192 Y233 F245 C247
BS06	7KZ	D	D1074 D1083 L1086 D1088 R1157 F1158	D157 D166 L169 D171 R236 F237	BindingDB: Kd=610nM,IC50=992nM

Gene Ontology

Molecular Function

• GO:0002039 p53 binding
• GO:0008270 zinc ion binding
• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:5ttf, PDBe:5ttf, PDBj:5ttf
• PDBsum: 5ttf
• PubMed: 28135087
• UniProt: Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 (Gene Name=EHMT2)