Structure of PDB 5t7h Chain D

Receptor sequence
>5t7hD (length=106) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
FKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYS
YTDANIKKNVLWDENNMSEYLTNPAKYIPGTKMAFGGLKKEKDRNDLITY
LKKASE
3D structure
PDB5t7h Cytochrome c Can Form a Well-Defined Binding Pocket for Hydrocarbons.
ChainD
Resolution2.003 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC D F82 G83 L94 F85 G86 L97
BS02 ZE7 D Y67 Y74 Y70 Y77
BS03 HEC D R13 C14 C17 H18 G29 P30 I35 S40 G41 Y48 T49 W59 M64 Y67 L68 R16 C17 C20 H21 G32 P33 I38 S43 G44 Y51 T52 W62 M67 Y70 L71
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
GO:1901612 cardiolipin binding
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
Cellular Component
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5t7h, PDBe:5t7h, PDBj:5t7h
PDBsum5t7h
PubMed27990813
UniProtP00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)

[Back to BioLiP]