Structure of PDB 5sva Chain D

Receptor sequence
>5svaD (length=178) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
VSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNL
SEARLVIKEALVERRRAFKRSQKKTREKELESIDVLLEQTTGGNNKDLKN
TMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKT
LIPSLNNKISDDELERILKELSNLETLY
3D structure
PDB5sva Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
ChainD
Resolution15.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D E158 G161 A162 Q165 E115 G118 A119 Q122
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003697 single-stranded DNA binding
GO:0003727 single-stranded RNA binding
GO:0003968 RNA-dependent RNA polymerase activity
GO:0005515 protein binding
GO:0031369 translation initiation factor binding
Biological Process
GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0001172 RNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0006397 mRNA processing
GO:0044237 cellular metabolic process
GO:0045948 positive regulation of translational initiation
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0000932 P-body
GO:0005634 nucleus
GO:0005665 RNA polymerase II, core complex
GO:0005737 cytoplasm
GO:0030880 RNA polymerase complex
GO:1990328 RPB4-RPB7 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5sva, PDBe:5sva, PDBj:5sva
PDBsum5sva
PubMed27610567
UniProtP20433|RPB4_YEAST DNA-directed RNA polymerase II subunit RPB4 (Gene Name=RPB4)

[Back to BioLiP]