Structure of PDB 5oco Chain D

Receptor sequence

>5ocoD (length=172) Species: 9606 (Homo sapiens)

YFQGMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVI
DGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHY
REQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSA
KTRQGVDDAFYTLVREIRKHKE

3D structure

• PDB: 5oco Small molecule inhibitors of RAS-effector protein interactions derived using an intracellular antibody fragment.
• Chain: D
• Resolution: 1.66 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GNP	D	G13 G15 K16 S17 A18 V29 D30 Y32 P34 T35 G60 N116 K117 D119 L120 S145 A146	G17 G19 K20 S21 A22 V33 D34 Y36 P38 T39 G64 N120 K121 D123 L124 S149 A150
BS02	9RK	D	K5 L6 V7 E37 S39 L56 Y71 T74	K9 L10 V11 E41 S43 L60 Y75 T78
BS03	MG	D	S17 T35	S21 T39

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005525 GTP binding

Biological Process

• GO:0007165 signal transduction

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:5oco, PDBe:5oco, PDBj:5oco
• PDBsum: 5oco
• PubMed: 30093669
• UniProt: P01116|RASK_HUMAN GTPase KRas (Gene Name=KRAS)