Structure of PDB 5nl0 Chain D

Receptor sequence
>5nl0D (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence]
RKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
3D structure
PDB5nl0 Structure and Dynamics of a 197 bp Nucleosome in Complex with Linker Histone H1.
ChainD
Resolution5.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D T29 Y39 G50 S52 S53 R83 S84 T85 T3 Y13 G24 S26 S27 R57 S58 T59
BS02 dna D R27 K28 R30 I36 Y37 R1 K2 R4 I10 Y11
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5nl0, PDBe:5nl0, PDBj:5nl0
PDBsum5nl0
PubMed28475873
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]