Structure of PDB 5m1s Chain D

Receptor sequence
>5m1sD (length=229) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDR
LVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGF
MDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDN
SKRTLHGALLDAQILAEVYLAMTGGQLSLPLAMEGETIQRIVRQASKLRV
VFATDEEIAAHEARLDLVQKKGGSCLWRA
3D structure
PDB5m1s Self-correcting mismatches during high-fidelity DNA replication.
ChainD
Resolution6.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D12 E14 E61 H162 D167
Catalytic site (residue number reindexed from 1) D6 E8 E55 H156 D161
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D D12 E14 M18 E61 V65 H66 S144 L145 G163 D6 E8 M12 E55 V59 H60 S138 L139 G157
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0004527 exonuclease activity
GO:0005515 protein binding
GO:0008408 3'-5' exonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006259 DNA metabolic process
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006272 leading strand elongation
GO:0006273 lagging strand elongation
GO:0045004 DNA replication proofreading
GO:0071897 DNA biosynthetic process
Cellular Component
GO:0005829 cytosol
GO:0009360 DNA polymerase III complex
GO:0030894 replisome
GO:0044776 DNA polymerase III, core complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5m1s, PDBe:5m1s, PDBj:5m1s
PDBsum5m1s
PubMed28067916
UniProtP03007|DPO3E_ECOLI DNA polymerase III subunit epsilon (Gene Name=dnaQ)

[Back to BioLiP]