Structure of PDB 5lmr Chain D

Receptor sequence

>5lmrD (length=208) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

PDB

5lmr Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.

Chain

Resolution

4.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	G2 I5 P7 V8 C9 R10 R13 R14 K22 E24 R25 K30 R35 R36 P40 G41 Q42 H43 Q45 K46 R59 K61 Q62 R65 S71 E72 R73 Q74 S113 R115 Q116 R118 Q119 R122 H123 H125 R132 V133 D134 L135 S137 Y138 K151 E156 L157 F206 R209	G1 I4 P6 V7 C8 R9 R12 R13 K21 E23 R24 K29 R34 R35 P39 G40 Q41 H42 Q44 K45 R58 K60 Q61 R64 S70 E71 R72 Q73 S112 R114 Q115 R117 Q118 R121 H122 H124 R131 V132 D133 L134 S136 Y137 K150 E155 L156 F205 R208
BS02	ZN	D	C26 C31	C25 C30

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lmr, PDBe:5lmr, PDBj:5lmr
PDBsum	5lmr
PubMed	27662086
UniProt	P80373\|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]